DPCstruct | MC34188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D5HB52 | 15-103 | LVGCVEQRKDIYALDGSRADGLLDVAFQGGANYDAGDINKALEIAAQKCKAWGYQGADKFGSRRTVCLASGLFGCLNSEQTVKFQCL… |
| A0A6L6JJW1 | 24-95 | VDSVITVSQVYTSTEPQPLNINKADKQALEMCQTRGFNTAERLGGEKQLCDRYTGWYECYYRRVDQQYQCSN |
| A0A828U8L2 | 1-79 | None |
| A0A1G6MFM7 | 1-105 | None |
| A0A7C8F6M0 | 1-76 | None |
| A0A2P5N8Z5 | 29-123 | None |
| A0A4R5QK28 | 1-105 | None |
| A0A6N6W7A1 | 48-156 | None |
| A0A1F8WVQ4 | 5-90 | None |
| A0A6N9CNW9 | 15-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.