DPCstruct | MC34186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 189 ± 32 aa |
| Standard deviation of domain lengths | 32.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 87.63 |
| Assigned Pfam label(s) | PF14744- PF14746 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0JEH1 | 36-207 | GLSALSCDAAAAVERVVTQVDDSLAAGDFYFYHLEKVFVEEMNSPKNSHLLNFFIIVPALTLNFVEHMLAAKDRLNKKSRDASFTDD… |
| A0A2G9UYL9 | 23-184 | STAKKLLQELREQANKDRDFTKMLVEKFRSAFLDDSKFSHLLDFYVAVPALMVNYVEHMLVCRDRLKKRAQLHKEITFTDDGFIMGL… |
| A0A0B1PDH3 | 2-143 | None |
| A0A6U0K852 | 1009-1215 | None |
| A0A5S6Q1S3 | 475-680 | None |
| A0A2D8AM95 | 196-410 | None |
| B4HB68 | 381-591 | None |
| A0A1D1XXP7 | 581-826 | None |
| A4I0W7 | 1252-1435 | None |
| A0A5N5SU45 | 2-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.