DPCstruct | MC3418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 148 ± 10 aa |
| Standard deviation of domain lengths | 10.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7VSP4 | 170-303 | LFEIYFDSNGDFRDVLKAEDLDSVLLLRKDHRFIKSFEFIREALSSYSDRLLYLPSDDDTPIGINIEMDLHKSNEDKQYITKISVGD… |
| A0A238DPT8 | 1-160 | MLFEIYFDSHGRFRDMLKFSYADKPLALAAEPVYDDARNFIRFQLNRYRARLKFLPGSREPLIVRIQSVPIDQHDEGTFPEPVNRLE… |
| A0A2M7PC97 | 246-395 | None |
| A0A2N2BVP1 | 349-495 | None |
| A0A7G8E5T2 | 165-316 | None |
| A0A158DNU5 | 101-256 | None |
| A0A1G6EUJ0 | 16-166 | None |
| C7CCP8 | 2-130 | None |
| A0A0C1ZF20 | 486-647 | None |
| A0A254SKC5 | 789-929 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.