DPCstruct | MC34178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 92 ± 2 aa |
| Standard deviation of domain lengths | 2.12 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 90.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5AX00 | 302-394 | FAGLQNGSPDGLALVDDMGGVLEFISYEGSFTASDGPAMGMDSTDIGVLEVGPTPVGDSLQRGGTGVTAVDFAWQMPLAETRGDVNA… |
| A0A6L9EXN8 | 276-364 | IQNGDPDGIALVNNDGVVVQFLSYGGTITANGGAANGLTSIDIGLTETELTPLGVSIQLQGSGNRFSDFVWNANITATRGTINLGQI… |
| A0A3B0SQ38 | 229-323 | None |
| A0A7V5V3R6 | 95-188 | None |
| A0A7S3Q2C4 | 109-200 | None |
| D5H5A0 | 118-210 | None |
| A0A1F7YG00 | 509-602 | None |
| A0A180EJY7 | 107-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.