DPCstruct | MC34176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 193 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.02 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF01915- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A373N9Q9 | 567-750 | TVSFKVKNTGKTEGKEVVQLYVADLCGISERPVKELKGFAKVHLLPGEEKTVSMEILARDLSYYEERLGDWYAPSGTYRILIGHASD… |
| A0A7S0ISY6 | 18-203 | VRLSLPQRAFAFYDVSASDWYVEAGDFEVLVGASCEDIRLSATIHVTSTAVRKSVGGSSVPRYLTLSDEALLHLGVTVGPAERARPY… |
| A0A645IBH4 | 1-185 | None |
| A0A813K2E0 | 175-362 | None |
| A0A0M0LQC8 | 301-508 | None |
| A0A1X6WUP3 | 211-378 | None |
| A0A355U1P3 | 229-432 | None |
| K4ZIZ3 | 15-191 | None |
| A0A416IMN5 | 151-334 | None |
| A0A6U9W8X6 | 502-730 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.