DPCstruct | MC34172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 117 ± 19 aa |
| Standard deviation of domain lengths | 19.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0II56 | 35-133 | AEEWLEEMRTYFSDKLSEANLRNVMKQATALATGAGVPHTIRAEAFRKGRPVTLDEDFAALRADANRFLRPEDDPGHGWRLDHPIGK… |
| A0A7S1BHT7 | 2-103 | SIFLQKVPHGNHSKTVSEANARMVMRQVRLLASGAGVTYHHWPKKVVFCKNRPIDLSENFEALFREAQQYEDQYGRDLGNGWLMRHP… |
| A0A7S3TDQ5 | 101-262 | None |
| A0A1E7EQM5 | 325-454 | None |
| A0A7S2VIL1 | 63-178 | None |
| K0R3Y5 | 237-339 | None |
| A0A7S0CHP9 | 3-97 | None |
| A0A7S3V9T0 | 141-269 | None |
| R1F0A7 | 2-96 | None |
| A0A7S2Q4P1 | 128-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.