DPCstruct | MC34169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 408 ± 78 aa |
| Standard deviation of domain lengths | 78.32 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167LKV1 | 48-457 | EDEDEYEEGEEFAPVRNGKEPARNGKEKAGNGSKARRARKARRKEEQEGDVKVATKAEILSLATDDPPGGKAKEKLEGVDEAVIQRI… |
| A0A059JB88 | 9-351 | ADLLSKESDEQVQFAGRSIVAITSTKEWSSYIQNEGFVNDAACAMKTFFDCQCYSTRKFDSIEWTFYGIAENTVAAARAFEMAYNLI… |
| Q4WL02 | 1-393 | None |
| A0A0D7AMX7 | 1-517 | None |
| A0A5N6L3Q7 | 232-642 | None |
| A0A6A6BBY2 | 26-519 | None |
| A0A7G5K8B8 | 1-234 | None |
| A0A6A6NVF6 | 1-399 | None |
| W9NG76 | 2-343 | None |
| A0A1Q3E433 | 24-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.