DPCstruct | MC34168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 216 ± 25 aa |
| Standard deviation of domain lengths | 25.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5Y5V2 | 1-210 | MNQMICAWLMLIPLFHTGEAVQQNNGCIRIRNEGHQPIVDVNVIHKYESEHSDKHTWGKVYPGVITKGEAGVTYNTGLGTTGSDWWF… |
| A0A059J9V6 | 1-211 | MLASIKSAMAGAANLVSGQAENTKTARVRVVNNTTRPIVAISVIHKCSNNSHKSHQEWVMVQPGKASMPEMEVEYPAGSGSSCSSGG… |
| A0A0F8A4K4 | 1-243 | None |
| A0A0F7ZTE7 | 23-275 | None |
| A0A2A9P214 | 1-233 | None |
| A0A151GMR7 | 23-234 | None |
| A0A2K2U958 | 1-204 | None |
| A0A2C5XVS4 | 2-161 | None |
| A0A2T1FYP7 | 46-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.