DPCstruct | MC34165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 60 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.73 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF20917- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0JFQ6 | 1-50 | MTEAEVVYTSEKYGSDEAGNGTESQPYKTVLHALKVKGLQATIYVDTKEE |
| G5BMK6 | 15-64 | AELYVADQEGNDATGDGTKEKPFKTGLKALMTLGKEPFPNIYVDSQKENE |
| A0A177VCZ3 | 22-72 | None |
| A0A2B4RK77 | 1-70 | None |
| A0A815V2S7 | 15-65 | None |
| A0A4U0XV22 | 1-57 | None |
| A0A7R9JFK5 | 159-232 | None |
| A0A820X703 | 2-65 | None |
| A0A183MR64 | 1-51 | None |
| A0A817N7N1 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.