DPCstruct | MC3416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 13.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H0MAT0 | 3-108 | NLISTYHRRILKAALIRHQRKTGSTCIVISLPKGGIATLEITEIVLDGLLVRFEKIARKEHGSVEGYKAIRDLYRNAVDVNGHGEYL… |
| A0A506P115 | 8-105 | VFPPELTTALYRRAIASAWRARHLADTGSEMRGPHRMTVERIEMAIALHIESAMVNEYGEAHGAAAALALLTDMVEPTLLTAPPALT… |
| A0A6N8K6E1 | 1-139 | None |
| X6QEZ1 | 69-167 | None |
| A0A3R8ZWJ2 | 4-107 | None |
| A0A366FCR3 | 1-108 | None |
| A0A447R733 | 57-172 | None |
| A0A833IYX7 | 99-225 | None |
| A0A5Z4EHU1 | 26-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.