DPCstruct | MC34158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 47 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0IA70 | 1-56 | MTTIAQAYKNCQSCGMPLARDEQKGGTERDGSKSAKYCSHCYQHGEFTMPDMTVEQ |
| A0A483CSK8 | 79-121 | VPSCGSCGMPMRSPGEFGTGADGSPSKDYCTHCYRDGAFVEPE |
| A0A366MCC2 | 3-49 | None |
| C7N2T6 | 65-110 | None |
| A0A3E5B6Q1 | 1-42 | None |
| Q8A8I0 | 2-49 | None |
| A0A810QCL0 | 46-87 | None |
| A0A1H6LL56 | 209-251 | None |
| D9SND6 | 2-43 | None |
| A0A3N5UQ82 | 27-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.