DPCstruct | MC3415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 226 ± 31 aa |
| Standard deviation of domain lengths | 30.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6U324 | 60-276 | SKEDKYLIDDWLFALQNLQEVEQWADHLSLLPECLHQIAGRYVEFKQALGQVDEQLNLSERLEQLHALQRRFFTKELIVLWFEEDNA… |
| A0A2A4F6H6 | 36-255 | DAVRAYIEKRLNDPARQEAIDLWTRYRHYREAEQKMTASLTDSSNQSSLDRMQLMLAQRTRLREQILPDVASSWYHDEEQADLDQME… |
| A0A6G8DEP9 | 22-220 | None |
| A0A1I3NRS3 | 88-346 | None |
| A0A1Y5H0J8 | 128-400 | None |
| N6WP20 | 40-282 | None |
| B1FKJ3 | 2-216 | None |
| A0A2Z6EWV0 | 32-249 | None |
| A0A7R9C3D0 | 15-200 | None |
| A0A099KDC3 | 89-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.