DPCstruct | MC34149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 74 ± 19 aa |
| Standard deviation of domain lengths | 18.59 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 74.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4EDS2 | 1-53 | MKCPSCGKAELKAHERRGVEIDICPSCRGVWLDRGELDRLIEIYAAYESEQER |
| A0A7V8QJ36 | 1-70 | MQCPVCDVTLQMTDRQGIEIDYCPQCRGIWLDRGELDKLIERSMQEAGGAQAPRTQPDHRGHHQGKHPKK |
| A0A7X9BFR5 | 2-52 | None |
| A0A151EEX0 | 16-66 | None |
| G2KS08 | 4-89 | None |
| A0A1R1IEZ8 | 4-81 | None |
| A0A6V8MBR6 | 1-98 | None |
| A0A3N2ANV4 | 1-83 | None |
| A0A7V9CIN3 | 2-55 | None |
| A0A7Y8IY05 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.