DPCstruct | MC34144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 176 ± 25 aa |
| Standard deviation of domain lengths | 25.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367LE50 | 224-368 | GPFAVVYSAACSEHQTYELCNGTVDWCRQSSSLALYGSETNCRNFRGEPPELLKWQPKADNCSDASEQCLGTEQVCNTLVPTDLRDD… |
| A0A168F9H8 | 1-177 | MKYSIVFFSSWAALAAAAPLDERQAEVKLPYKEPGQFSIDCGFRGSDEETCGTDWYCTAFDESPKPLGLDGPYESSKECFDAHEPRE… |
| G3JSD2 | 16-224 | None |
| A0A2A9P322 | 1-183 | None |
| A0A367L5C8 | 142-334 | None |
| G3JPA0 | 1-169 | None |
| A0A0F8A5A2 | 96-306 | None |
| A0A2A9PBR2 | 1-166 | None |
| A0A179GD58 | 1-215 | None |
| J4KL24 | 1-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.