DPCstruct | MC34135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 22.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9FUE6 | 2-70 | KLSRYEQEVVIKLNDDEDEATVYTANPVWIRKMDKLHKEFPNIIRLKSWTEVSKTYVLPQNLVRMERQE |
| A0A316QDG5 | 2-103 | SITKAEKETVILFDEADDRAEVYTHNTKLKNRLARAANKHPQTYVLKYQNSDGGVSYAFPKKYLTVMFREPISDTDRERCKANCRNV… |
| A0A1F6PKS5 | 25-119 | None |
| A0A843GMS9 | 22-104 | None |
| A0A0F0CK13 | 3-63 | None |
| A0A2P7AHA0 | 1-81 | None |
| A0A413WUB6 | 5-90 | None |
| A0A0F9F1N6 | 1-94 | None |
| A0A564VLF2 | 63-159 | None |
| A0A810QCG1 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.