DPCstruct | MC34131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1JB70 | 20-147 | MAVERAINRHVGNLIHLFLSLLAILILGAAVIAAYDTVVSEFPKLFQPTDEYVVLQKIIENILLVGIAAELGLLLLFHRSSAAIEVI… |
| A0A316PF03 | 2-136 | RQKIQKKMFEFCYLLELLISCVIGIAVVILGVRLFLEMINLSVFSGGDKILETILDKAMILAIGVEFIKMLCRHTPETVVEVLLFAI… |
| A0A842W841 | 14-152 | None |
| A0A1I7FNM8 | 48-162 | None |
| A0A416PTH4 | 1-134 | None |
| A6USH2 | 2-129 | None |
| A0A1I5BEW2 | 134-245 | None |
| D4IYF2 | 5-123 | None |
| K0AXZ3 | 3-126 | None |
| A0A3C0D1X0 | 13-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.