DPCstruct | MC3413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 17.74 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 51.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446JMM7 | 1-102 | MDFAVNAALWVVGKALAPVTDGLLESWAASAGLGANIDALKMQLLYGQGMLDNAQGRDIRSPALKELLHKLRELAYGADDVLDELDY… |
| A0A0E0RHA9 | 1-106 | MEFAVSAARWVVGRALGPVTGELMEAWAASKKLGPNIRELKLLLLHAQAMLENAEGRDIRSGALDQLLSQLRDLAYDADDVLDELDY… |
| A0A835AJT7 | 1-111 | None |
| A0A0A9DNY6 | 1-101 | None |
| T1NFN0 | 52-178 | None |
| A0A453A6R6 | 146-243 | None |
| A0A3L6PV56 | 26-152 | None |
| A0A833RKE7 | 5-133 | None |
| A0A3B5Y7D6 | 5-102 | None |
| A0A446LXM5 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.