DPCstruct | MC34126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 4.60 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512JBS4 | 1-89 | MRDRLSERLQRYKHHRILLVAHSMGSVIAYDVLRLLERDDPSLQVDHLVTVGSPLCLAKVKLKFEAEHWALRVPNNVAAWRNLADGS… |
| A0A536W828 | 78-169 | IFTRDVFLYTTRAGVRDEIDQIVAGKLTEQPTVVVSHSLGTVVAYSVLRTDRRSLRIPLFVTVGSPLAVRAVRDQFRPLRSPSSVDA… |
| A0A3R9X1J8 | 41-133 | None |
| A0A536TQ85 | 6-97 | None |
| A0A4Q4DTC9 | 1-80 | None |
| A0A1H4PH06 | 50-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.