DPCstruct | MC34123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 105 ± 23 aa |
| Standard deviation of domain lengths | 23.01 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 91.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H3FC39 | 16-103 | FLPPNTPRTIYNLFYGAIPPLPENKRHEKISALDMAPTILQCAGAKWNNDQFGLGVSLFSSRSSLLQQLGTDKLNSILMGKSALYETF |
| A0A1M7JMS3 | 585-656 | INAQKEPVNAKNRLFTPMDMFPTTLSAIGVDIEGDRLGLGTDLFSDKPTLCEELGKDKFLQQIQLNSKYFQK |
| A0A7R7BF19 | 169-269 | None |
| A0A1H7TAM8 | 417-488 | None |
| A0A4S3LRR4 | 150-259 | None |
| A0A357NKZ9 | 124-257 | None |
| A0A376FJY3 | 312-441 | None |
| A0A379AL13 | 223-352 | None |
| A0A376NZH4 | 94-223 | None |
| A0A3R6MUS0 | 13-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.