DPCstruct | MC34122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 95 ± 15 aa |
| Standard deviation of domain lengths | 14.65 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.17 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF19363- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5UNL1 | 69-156 | ESGAASELLSNGDETSYVFNTAGEFSIFCEPHPVMQMTVLVEEGSEQTGKVAVDIADYAFGEKTITVAPGTTVTWTNQDQAQHNVAIK |
| A0A2V3I1S9 | 4-113 | WDSGELAQNESWSHTFTMASNDMYSCTPHPPHEGFPDFTGWVNVSDDSDARADDVTIYIDGFSYQPSTVKIQPGVTVTWVNNDSAVH… |
| A0A7C7N3X1 | 29-125 | None |
| A0A1I4UNU3 | 415-487 | None |
| A0A534W748 | 310-391 | None |
| M0DAF5 | 105-209 | None |
| A0A7V9SH25 | 335-421 | None |
| A0A4Y8LBV7 | 88-177 | None |
| A0A158L3Z4 | 1-88 | None |
| A0A7W8CQ40 | 4-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.