DPCstruct | MC34120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.94 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 49.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W8YS58 | 20-89 | EKYTDLSTVESQRNDLTFEEFPEGPYGAVLHEEEPVKSTPWRPEQRQPNRFGYENRALHGSKEREYPGDD |
| A0A0C2R045 | 5-76 | EEYSDFSNVEVGREYLIPETLPEGPYGSPRGKYTLVRNKSTPWRKGQRYYSAFNYENKGLHEDIPRAVPGSH |
| A0A4S3PKB1 | 1-76 | None |
| H3SI26 | 9-79 | None |
| A0A1N6Y5M6 | 7-75 | None |
| A0A4R6U4L7 | 3-82 | None |
| G9QH21 | 10-99 | None |
| A0A4R3KJ08 | 22-106 | None |
| W7ZD63 | 4-81 | None |
| A0A554A4L5 | 4-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.