DPCstruct | MC3412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5CST8 | 1-88 | MKVELLFITPEAEKLIETAGRTSYLSSGKQGKDTEKAFIRMLIKRGHLSVLEHAYATFRISGISRAFTHQLVRHRLCSFTQQSQRYVD |
| A0A7C2KDD1 | 5-104 | ILDRGFVELIDMMGNDLSAVRAARVSFDMGLKDEERDKHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRY… |
| A0A661GUN3 | 4-125 | None |
| A0A7C0TXK8 | 3-116 | None |
| A0A662MBF7 | 2-111 | None |
| A0A497SZA2 | 1-114 | None |
| A0A7Y5RRU8 | 78-192 | None |
| A0A2E7WAB9 | 33-135 | None |
| A0A7C7V9Q7 | 3-105 | None |
| A0A0F9X986 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.