DPCstruct | MC34115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 260 ± 25 aa |
| Standard deviation of domain lengths | 24.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1WA97 | 1-273 | MDAAQDHLRNGDLDQAVEIWKELVLKGGVYADSARLDYAEHLFDEYEYDDAYTQLHAVLAPWRIFSKSWLRAVEMVEQHEPEVALHL… |
| A0A7U8UZW6 | 7-240 | RDPAPWVIAAEALESHDELEAAHETFTEGARLLLTDVPEPPYSTHPLLYGRHRVRRMLGLAHDAWDTLADTLHSMPVSLDELHDPKR… |
| A0A4R8CPH0 | 27-283 | None |
| F3ZBI1 | 224-522 | None |
| A0A4Q7KIN9 | 82-330 | None |
| A0A850DCM2 | 207-477 | None |
| A0A4V2S1W6 | 57-325 | None |
| A0A542EM88 | 2-211 | None |
| A0A838S436 | 33-319 | None |
| A0A810LQE5 | 1-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.