DPCstruct | MC34113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 247 ± 25 aa |
| Standard deviation of domain lengths | 25.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656BZG2 | 1-252 | MNVTFDKLAPEVQNAVMVKFDTCENITVDMVISAQELLQEDMATFDGHIVEALMKMPEVNAMCPEIKLHAIGWIKHKCKPGAKWPEI… |
| A0A376LMM8 | 1-229 | MLLPISGQELPIRWLAQHGSEKPVTHVSRNELQALHIARAEELPAVTALAVSHKTSLLDPLEIRDLHKLVRDTDRVFPNPGNSSLGL… |
| A0A7I6XU04 | 2-221 | None |
| A0A376FCW8 | 19-234 | None |
| A0A0K1H0Q4 | 81-332 | None |
| A0A504Z4Y7 | 2-228 | None |
| A0A377BIU4 | 312-497 | None |
| A0A2X6RLG2 | 77-355 | None |
| F4TGA8 | 102-353 | None |
| A0A376ZUK7 | 11-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.