DPCstruct | MC3411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 248 ± 47 aa |
| Standard deviation of domain lengths | 47.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.94 |
| Pfam Score | 72.59 |
| Assigned Pfam label(s) | PF11901- CL0369- CL0158- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5RM91 | 336-558 | FVKDYFPVDVHTNEATFDIQYGNVKRDTHDNTSWDFAKFEVCHHKWLDVSEDGYGVSMINDCKYGVSVRGGLIGMSMLKSAIHPNPD… |
| A0A660RMZ4 | 19-263 | EIEAGEPFGMIKRRYKSLSVEDQEKQIQQGGYRESEVNFYPFQKLLIIDDGENGYAISTLDLTEYEYNVVGNYSILELTLVRAIGVL… |
| A0A5N5TJM9 | 29-293 | None |
| A0A7J9RKU6 | 897-1149 | None |
| A0A7R9PXK6 | 498-768 | None |
| A0A7R9Q162 | 418-697 | None |
| A0A1B0BVW8 | 120-355 | None |
| A0A3E1NX09 | 527-725 | None |
| A0A0S8AJR1 | 533-767 | None |
| A0A821RDM1 | 434-728 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.