DPCstruct | MC3410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 14.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 24.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3S4B1 | 2-93 | QGALDRLAKAQGALERGWLPEKGELIGKTVSIIAGLKDVLDFEQGGEIATNLDRLYDYMIRRLSEANRNNDPVILEEVSGLIREIKS… |
| A0A660RDR1 | 9-129 | ASYRERQIMTAPPEYLVALIYKEAILHCKKALEYFNTKDISAISNSIIKVESLIIELLSSLDEEKGGEIAKNLKTLYLYMYRLLVDA… |
| A0A7C1K2X9 | 1-104 | None |
| S0EXM0 | 33-157 | None |
| A0A4Q3WQ12 | 20-142 | None |
| A0A1E4B5Y3 | 18-137 | None |
| A0A7C1TCF0 | 8-123 | None |
| A0A1H9VKW6 | 8-143 | None |
| A0A523F9H7 | 5-139 | None |
| A0A0A1H9J3 | 26-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.