DPCstruct | MC341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0508 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519VN96 | 36-98 | VNPVWNIPKSIAGKEIMVSLQNNSSYLEENNMVAYNNAGEIVDASSIDWSSASVNDYAFKQNP |
| A0A2X4YKS9 | 1-72 | MVVNPPWNVPPTLARKDILPKVRNNPGYLEQHGYTMMRGWNSKEAIDPYQVDWETITASNLPFRFPAGSRRA |
| A0A1W1CZZ9 | 313-389 | None |
| A0A1N7NJX8 | 356-431 | None |
| A0A0T5Z418 | 354-429 | None |
| A0A6G6X0C7 | 264-333 | None |
| A0A0M4DFE6 | 363-427 | None |
| A0A847ZSW1 | 100-167 | None |
| A0A0R2V280 | 77-147 | None |
| A0A377W6G0 | 44-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.