DPCstruct | MC34091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 157 ± 32 aa |
| Standard deviation of domain lengths | 31.78 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SJ54 | 2-150 | QKNAHDLPVYLGYAVPLGLDSLYRLRSIFLPLGKIGGKPSWLNPKFLPTSAELECPICQKQMCFLIQVYATSDNDPPHSFHRSLFIF… |
| A0A016VXN0 | 24-175 | YRLRSIFLPLGKIGGKPSWLNPKFLPTSTQLQCPVCQKQMCFLIQVYATSENDPPHSFHRTLFIFICRNPHCSRPNDPSNMTVFRCC… |
| A0A183Q7K9 | 3-132 | None |
| A0A388L2M3 | 1-225 | None |
| A0A1P8BBQ2 | 10-196 | None |
| A0A1J8QK13 | 41-204 | None |
| A0A1Y1WEP8 | 1-209 | None |
| A0A7D9F1F1 | 14-172 | None |
| A0A7N4NZC7 | 19-170 | None |
| A0A2K3NX60 | 484-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.