DPCstruct | MC34090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 192 ± 25 aa |
| Standard deviation of domain lengths | 25.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SI09 | 15-187 | SAVSLVDSFCKWLAEALHSCPVKLESLLTVCTACNRALIRERDKQSISRAVVAEMIQAIKFKCPLQETNFMTIANLILQDAGEDIEM… |
| A0A4U5N1W5 | 490-677 | IKTELKCAISIMNVVLKVQNFSTFKSGVALVDAFSKWVNEALHECKVDLLDLLNICTACNRALIKERDKQCMTRSIITELVQALKFK… |
| A0A8B6BZP8 | 372-568 | None |
| A0A5E4C052 | 106-269 | None |
| A0A4C1UQZ5 | 307-506 | None |
| A0A817L482 | 30-242 | None |
| A0A6P4Z843 | 1-259 | None |
| A0A077YX75 | 1805-2006 | None |
| A0A0N4UA33 | 1542-1710 | None |
| H2XMW4 | 11-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.