DPCstruct | MC34088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 186 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 46.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SHK5 | 2-188 | RRLWVEFFPVLCSSLESENEIEVIESFIDSIAECVMQLGAGGLTKEDVEKITMVISEQLKAHEDRRLEAEAEEAEEDADADEVKEKL… |
| A0A453H5J4 | 71-252 | PELLRSAKLAVEKGQAQGRDNSYLKQLSDYIVPALVEAMHKEPETQICASILESLNESIQMSGTLLDEGQVRYIVEGIKEVITASSN… |
| A0A2G3AQ31 | 23-206 | None |
| A0A6A3ANZ0 | 399-577 | None |
| A0A2U1N220 | 594-803 | None |
| A0A6P5RGV3 | 71-226 | None |
| A0A1S4AEQ4 | 1-194 | None |
| A0A2I0B3T3 | 162-364 | None |
| A0A2G2VDL1 | 16-191 | None |
| K7M6L4 | 33-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.