DPCstruct | MC34087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Standard deviation of domain lengths | 9.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1PAN4 | 3-87 | RKTRQPVTSSCVGTDANRNFDFHWGEVGASSLSCADTFKGKTAFSEPETQLLRDLMLSLSGRAKFYLTLHSYGNYLLYPWGYTSA |
| A0A0B1SGY0 | 1-75 | MRSREPRLPPKIRQWRKNRAPANCSGFTALSKEVCCEGVDLNRNYDLGFSQENYPFNNPCSDEFQGPYPFSEPET |
| A0A158RAL1 | 179-248 | None |
| R1CIJ9 | 25-100 | None |
| A0A0V0XQD4 | 246-310 | None |
| A0A7R9E1T0 | 8-87 | None |
| A0A7R9HKI2 | 120-194 | None |
| A0A235BQN8 | 2-68 | None |
| B4JM54 | 854-913 | None |
| A0A0B2W6U0 | 248-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.