DPCstruct | MC34086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 200 ± 12 aa |
| Standard deviation of domain lengths | 11.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.76 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0123- PF11616 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SGX1 | 2-189 | EVYNKVKKDYDDRIANEEAPTFAKNVSQLPIRLYHTYDDSTPTPLDLERDDLSEFISHFKTTDCRSMNAQRCGVRFLPALELRPRTA… |
| A0A0N4YKL3 | 95-285 | MEVYNNVAKEYYDRIKKEEGPNFTKIVKKLPLRRYHTYDDSTPNELCLEPDDLSEFITHFKITDCRNMNAQRCGVRFLPALELRPRT… |
| A0A183K9G4 | 34-249 | None |
| A0A2K6LD85 | 21-240 | None |
| A0A7J5Y978 | 1-218 | None |
| H3C7G6 | 2-205 | None |
| A0A183VLH2 | 10-198 | None |
| A0A1I7U7N6 | 95-287 | None |
| A0A3P6RKJ7 | 1-195 | None |
| A0A401Q5J8 | 32-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.