DPCstruct | MC34085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 138 ± 14 aa |
| Standard deviation of domain lengths | 14.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9QF52 | 610-756 | SPYHIEQQATFIRTASTKVESYTNVEPTNRSGLELKYGPYVDQPPHSFSPIIVHFENNNPFVVIEDLVREVEISHWGSVQVREQYTL… |
| A0A0B1SE20 | 17-152 | NQENERIVYGPYKDQPPFNTKNIKIHYENNSPFVVASVIERTIEISHWGNIAVEEYIELVHKGAELKEYFKLFIRLQGPFSRIDFQL… |
| A0A4Q4W5K5 | 145-296 | None |
| A0A7S3KQP3 | 17-160 | None |
| G0QS86 | 156-300 | None |
| A0A2P6PPA6 | 15-158 | None |
| A0A044T2S6 | 218-359 | None |
| A0A1V9ZXD0 | 149-297 | None |
| A0A1J8QDD3 | 316-472 | None |
| A0A3L6G5D8 | 140-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.