DPCstruct | MC34083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 222 ± 53 aa |
| Standard deviation of domain lengths | 53.29 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7PAT0 | 32-233 | EKKDEDLSDEDLALKQQLELYVERVQDSDPGVQKLALESMRNLAGEIAQEFQKRQYDDMPIDALMELVQQIVAFHMKHNAEPEAVDL… |
| A0A0B1SCE7 | 2-201 | LEPIGDWGHEYVRHLAMEMSEEWKLAAGDSEKSKARRNELLVLARDIVMHNMKHNAEVEACDLLIEIERLDLLMEYVEDVDHQRVCL… |
| A0A4Q2DGJ1 | 124-427 | None |
| A0A287XHG4 | 2-318 | None |
| A0A287XHL4 | 29-258 | None |
| A0A6F9CK22 | 31-302 | None |
| A0A2P5XZE3 | 60-242 | None |
| A0A453SPX4 | 2-215 | None |
| A0A0C9YKG5 | 141-431 | None |
| A4I449 | 175-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.