DPCstruct | MC34082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 179 ± 12 aa |
| Standard deviation of domain lengths | 12.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7TKV6 | 110-303 | DSKDPPPSIPDEKDLLTVRNNLEMAENCERDKPFAQIQDQLKSVQITLEARLDTLLQHWNLEQKLTFLQNHRVREEQQKATQRPVVL… |
| A0A0B1SAR2 | 1-164 | MSSGKVRSKRSLKISELTSLRVTAEAGLERFIQHWDLEQKLSFLPRKQDEKPRQRPVVLRKRRQRVRSSVNWKLFAYQFGRDHSQAD… |
| A0A368FDJ1 | 135-317 | None |
| A0A818BBH9 | 481-676 | None |
| A1Z7S0 | 671-834 | None |
| A0A6J0YW09 | 666-849 | None |
| J9DX91 | 1-183 | None |
| A0A482VMC3 | 589-775 | None |
| A0A1B0DCK4 | 511-674 | None |
| A0A182EI93 | 380-577 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.