DPCstruct | MC3408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 132 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03862 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0KEB7 | 49-196 | IEGAKDYARLVAQWAPKPNVPLLISRAFLVGGSICFAGQFVFDYFRQRQPTEVEAIALTLATMISAGVLLTALGVYDHLGELGGMGA… |
| A0A7H1S056 | 9-136 | ETKRPIVRNCVCAFLVGGIICVIGQAISYFYMYFLTLPSKRQAIRRWRRWSLSMILTGLGVYDRIAQFAGAGSAVPVTGFGNAVISA… |
| A0A1G6LK36 | 10-152 | None |
| A0A832QG10 | 3-124 | None |
| A0A7M2AJ02 | 24-161 | None |
| A0A350X404 | 4-146 | None |
| A0A7V6G9N5 | 3-132 | None |
| A0A373NB39 | 336-453 | None |
| A0A7C6LGC4 | 29-170 | None |
| A0A0N0I696 | 94-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.