DPCstruct | MC34078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 11.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1S5V8 | 1-104 | MPTIYRALLELVEDSIEISYNSAGVLAHMVSDGEEAWNCLTVRREDVMASVVKATNAWRLDTRRFINYRSFRPILRLLPLWHAYASQ… |
| A0A6G0II56 | 313-444 | IQQKLLGLLNNIAEVEVLQADLLEEDLLEHILSLLKDSHVEVGVRYFAGGILAHLTSRPEAWTLGDELRSTILKQLHASIITWTQPE… |
| A0A2A3EFV7 | 128-251 | None |
| A0A310SIZ1 | 552-675 | None |
| A0A3M6UIK9 | 541-675 | None |
| F6Y9R7 | 372-506 | None |
| A0A7I8VI00 | 452-578 | None |
| T1GPQ1 | 12-117 | None |
| A0A4Z2DI96 | 208-350 | None |
| A0A6A1QBS7 | 274-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.