DPCstruct | MC34073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 207 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7NP75 | 637-847 | LPKDVDPFFQTLDLDGIGYLEAKKIYDILLKSTPESRNIFGRLSGDAGAWEAIVHAFEKDHIYLGEAAQIMVQNVNYEIPYQKKLVQ… |
| A0A0F8AC49 | 229-414 | QDMPENEEIKQLLSGSYIHYFHCLRIVEILKGTEASSKNIFGRYSSQRMKDWQEIVSLYEVDNLYLAEVASLLTRNVSYEGPALRKQ… |
| A0A0N5D8H7 | 43-261 | None |
| A0A453RF34 | 2-220 | None |
| A0A0N4YFJ0 | 48-265 | None |
| A0A812DMY1 | 113-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.