DPCstruct | MC34071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 2 aa |
| Standard deviation of domain lengths | 2.14 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 62.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1S1P6 | 1-69 | MNIMMLSVMKHTTKPVKFWLLKNYLSPQFKKNLPLLSAEYGFEYALVEYKWPRWLHQQKEKHRIMWGYK |
| A0A1B7NXC8 | 206-272 | NIMMVSVMKHTKHSVKFWFIEQFLSPSFKSFLPHLAAEYGFSYEMVTYKWPHWLRAQTEKQRIIWGY |
| E7F6G9 | 1251-1317 | None |
| A0A0G4N9E1 | 580-646 | None |
| A0A3Q0KM82 | 1166-1232 | None |
| A0A7J5Y7N8 | 193-259 | None |
| A0A6A6N2F5 | 592-658 | None |
| A0A0M3JBP0 | 28-98 | None |
| A0A7T8H1B1 | 770-836 | None |
| A0A5B0N204 | 937-1003 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.