DPCstruct | MC34070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Standard deviation of domain lengths | 16.31 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1S158 | 13-112 | ADFAPIASNMYQCMTIACLCSFFGGIGGDSCTIQGRPLRKAFRKEYRQLSDEERNRVHAAFRALKNSGEFDHLATVHAQFSTSGGAH… |
| A0A6V7V504 | 5-103 | DELNCLNLSCICPVFKGNKDGTVNGCKLPNGKNLNKCFREELRMLSDEKRQAYFKAVQQMKDNGAYDLCAIQHRDAYLLKGAHRGPA… |
| A0A0D6MD13 | 1-95 | None |
| A0A3P7I1A5 | 10-99 | None |
| A0A3P7M3Y8 | 23-129 | None |
| A0A0M3I6I9 | 46-147 | None |
| A0A368G875 | 60-157 | None |
| A0A368FM62 | 277-387 | None |
| A0A0B2V753 | 69-190 | None |
| A0A0J9YFM9 | 61-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.