DPCstruct | MC34067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1RY39 | 1-86 | MSKDSFDPRTFFALHDLNGDGYWNAEELEALFQKELEKLYNETDPDDDPRERMEEMYRMREHVTKQMDKNGDRLISLEEFLKIVLV |
| A0A822I1G6 | 58-133 | LDPNDFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDSNHDRLVT |
| A0A1D2NKG0 | 239-320 | None |
| A0A3P7L4W7 | 1-93 | None |
| A0A7J7IUQ8 | 240-318 | None |
| H3C7I4 | 165-248 | None |
| E4XS77 | 228-308 | None |
| A0A091DTY2 | 247-328 | None |
| B4QPA6 | 394-474 | None |
| A0A0C2D0A3 | 123-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.