DPCstruct | MC34064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 131 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09332 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1RW31 | 13-148 | TAPKQSRLISLENEIDLDKLLERKSIHENEANKAHALAAQKHLDLLEQKEKVESFVTECMSVKNVKVVSCKKCDYIAQKQSDMCKNE… |
| T1GDT4 | 44-162 | IERIMAATSSHKNLVEQRHDEEQEKYFSKLEKKEAMEEKMLNTFQVDCKAVICQQCKYTAFSAADRCKEEKHPLKVINATKRFFQCK… |
| A0A4W5RW27 | 5-121 | None |
| D8M4K7 | 376-488 | None |
| H2YLZ6 | 2-125 | None |
| A0A1Y3BYN8 | 3-116 | None |
| A0A2H2I5E2 | 107-246 | None |
| A0A6V7WFL2 | 433-575 | None |
| A0A669CHK5 | 583-723 | None |
| E1EX23 | 202-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.