DPCstruct | MC34063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 10.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1RVL6 | 9-98 | IHTDSMTLQRFVLAEQKNHPEASGDFTHLLTSLLTAVKAIASATQKAGLAKLYGIAGSTNVQGEEVKKLDVLSNELMINMLKSSYTT… |
| A0A504XRD0 | 328-433 | TLTQYIIKSQPPHSRGEFTLLMMAIQTSVKVIEKNIRRAGMKGMLGYIAGQSANATGDHQAKLDVISNMAFKAYLLSSTSVCVLGSE… |
| A0A1G5J7S8 | 1-106 | None |
| A0A1R3JRM5 | 444-546 | None |
| K8ELW7 | 59-163 | None |
| A0A5S6QKP5 | 54-137 | None |
| A0A2N2UR54 | 2-103 | None |
| A0A1I1XYS5 | 1-140 | None |
| A0A4S4EWD1 | 1-80 | None |
| A0A2P6PE22 | 8-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.