DPCstruct | MC34062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1RUQ4 | 13-99 | TQTKLIRFYFQSLQFLVRDWSFPYEAEFGYEGGQKIMEERLQVSAKQHPELQQLRQHIRSCFEKISCFLMPYPGIKVATNPSFNGSL |
| A0A402G1A1 | 17-112 | QLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGAEGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTKISCFLLPHPGLKVA… |
| A0A3M7PR32 | 141-242 | None |
| A0A3P7JB30 | 2-95 | None |
| T1HDJ8 | 209-305 | None |
| A0A194PFQ6 | 426-525 | None |
| A0A3P6TF75 | 108-221 | None |
| A0A6J1WV64 | 102-200 | None |
| A0A7R9KDX3 | 99-213 | None |
| I3MFB3 | 36-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.