DPCstruct | MC34059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.81 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 31.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6NQH1 | 144-226 | TKILNPDVLRFRYNKAAKKLRVWAVETLQIENKALGYHIKYDLGHYESDFAERTIQYSGYANYTVLSDKRSIRRNREKTYNSS |
| A0A7J5WM41 | 65-139 | CKLLNKEVVRFRFNKKTNTLKAYADQPLHIQNEALGYELKYDLNVFEFNYSTRVLFYQGYPLFSDLEAKNDRVET |
| A0A1G0R6Z7 | 11-74 | None |
| A0A7Y3WBZ8 | 10-81 | None |
| A0A7Y3WBM9 | 35-107 | None |
| A0A7Y3RXE3 | 51-122 | None |
| A0A259HWH2 | 435-509 | None |
| A0A3D3P9Z1 | 231-306 | None |
| A0A7D4TNA0 | 133-206 | None |
| A0A4Q5ZD65 | 96-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.