DPCstruct | MC34052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 208 ± 31 aa |
| Standard deviation of domain lengths | 30.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF12879- CL0474 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B1E5Q2 | 10-217 | RGDDCKDKPTLCDRAQCVTDTWFTIRSRKDKRDADWVEYWKDIGLELEKLSTAITTESTRDDNLCEGITVADNKTEGANKKACNYIV… |
| A0A1Y3DZC2 | 5-205 | FTAIFTGLLNDMKTNQHSITKHCEKNNGVPWGSDAHDVANQTACKLVAAGLYHISNIKEVYDSVNQQNPYDNQEFKQFASCLMLKAV… |
| A0A1A7VW52 | 196-419 | None |
| A0A1B1E2S5 | 330-534 | None |
| A0A1B1E6A0 | 294-494 | None |
| A0A1A7VD47 | 7-264 | None |
| A0A1A7VU50 | 270-495 | None |
| A0A1A7VVD9 | 722-985 | None |
| A0A1A7VW79 | 451-659 | None |
| A0A6H5FV32 | 3-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.