DPCstruct | MC34051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 290 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B1DSX8 | 18-325 | INARGDPAYTGMQDLLWVELKKAFEDMMENINDDAEDEKPMCAKRIANGKSTSWGNTEKKLCKILIRLYSWMDGLERKPNWGERGKL… |
| A0A1B1DZ27 | 4-300 | KYFAEFLVEWLKVKGYKSSGDYHKIWDDIREIFDGIMYQAWLGPPQINQLCSGEVEDGEKKNFTKQDKELCKAMVRVLLYINGQKIG… |
| A0A1B1E371 | 59-367 | None |
| A0A1B1E642 | 7-279 | None |
| A0A1B1E681 | 194-485 | None |
| A0A1B1E6A0 | 2-289 | None |
| A0A1B1E6H7 | 220-494 | None |
| A0A1A7VZL4 | 9-327 | None |
| A0A193R2V7 | 1-324 | None |
| A0A1A7VFY3 | 185-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.