DPCstruct | MC34049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 122 ± 24 aa |
| Standard deviation of domain lengths | 24.02 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 93.10 |
| Assigned Pfam label(s) | PF02138- PF00238- PF00410- PF00347- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4H9J1 | 245-376 | PMYDFCHRLREASEQRKRFVIVPSTIETRGCAKVLLDHGLVAGFRDFNNDRAFAVELKYFQNEPTINVVEPCSYDGKTEFEWSPKMM… |
| A0A832LQP5 | 1-89 | GFIDGFEVIDDGTKQKEIRIRLKYTSAGDKVIHEIDRASKPGRRIYRKVGDLPRVLNGMGIAVVSTSKGVMSDRRARENNVGGELLC… |
| A0A7J6PHP8 | 9-121 | None |
| A0A6A5UWB7 | 2-89 | None |
| A0A1V2LL59 | 5-157 | None |
| A0A834T4Q7 | 6-126 | None |
| A0A1E4ZLX9 | 5-96 | None |
| A0A366QP29 | 484-641 | None |
| A0A835RLI5 | 60-161 | None |
| A0A1B7N6I4 | 6-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.