DPCstruct | MC34048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Standard deviation of domain lengths | 10.44 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9CPP9 | 1-54 | MVGGIPQTQEMLDFCAEHGIGAEIELIPASDINDAYERVIKSDVRYRFVIDTAT |
| A0A1N7CEW1 | 9-73 | LLLGRRRIAGSPIGGIRETQEMLDFCAEKNILPDCEMINMEQINDAFARMECADVRYRFVIDMAS |
| A0A2P5FH17 | 1-46 | None |
| A0A6A2XC61 | 159-229 | None |
| A0A835AS34 | 11-73 | None |
| A0A1U8K4I0 | 19-87 | None |
| E0CQY3 | 89-161 | None |
| A0A366BZ94 | 3-67 | None |
| A0A2N9G636 | 98-161 | None |
| A0A2P6S185 | 67-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.