DPCstruct | MC34042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 361 ± 54 aa |
| Standard deviation of domain lengths | 54.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15611 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8D6R9 | 32-393 | PTLMAAVEQDAQSLDRAVVAGYLRHFPTSHPEFETLNSAARFTAERRDWVWRERGKRWELWDHRNAPSRLAKAMLGAGVGEPVLSDA… |
| A0A089LTA5 | 16-333 | ESLDTVYKINQILTARYSIEVGKTAWVLFQHGYEEPVLEDLLQRIYSIDRFAFLGLEDELQHHLDQAFVNNQGTAEGLAAALFQMEM… |
| A0A231MU31 | 8-396 | None |
| A0A0J9EZT7 | 1-384 | None |
| A0A142NN98 | 16-376 | None |
| A0A348PM86 | 43-441 | None |
| A0A7C6W5J2 | 1-301 | None |
| A0A7Y7AV19 | 4-319 | None |
| A0A7C6WZI4 | 51-412 | None |
| A0A7V5SRP4 | 68-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.